For laboratory research use only — not for human or veterinary use. Not evaluated by the U.S. FDA.

Cellular Peptide
PNC-27
A peptide combining a p53-derived domain with a membrane-penetrating sequence, studied in cell-culture research for its reported selective membrane activity against transformed cell lines.
Quantity
$99.99
Bundle & save
Order by 3:00 PM ET for same-day dispatch
Cutoff 3:00 PM ET · same-day dispatch
Estimated arrival in 2 business days
Overnight shipping available
Free shipment protection included
PNC-27
1 × 30mg · $99.99
99% purity, QC passed
HPLC + mass-spec verified
Shipment protection
Free on every order
Free shipping over $150
Same-day dispatch before 3PM ET
Certificate of Analysis
Third-party tested · Independent analytical lab
30mg
99.59%latest
| Tested | Measured | Purity |
|---|---|---|
| Jan 2026 | 31.36mg | 99.59% |
| Sep 2025 | 28.32mg | 99.74% |
Frequently researched together
Commonly studied alongside PNC-27.
Compound information
Technical specifications
Molecular profile
| Type | Synthetic peptide |
| CAS number | 1159861-00-3 |
| Molecular weight | 4,032 g/mol |
| Amino acids | 32 |
| Sequence | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
| Formula | C188H293N53O44S |
Storage & stability
- ❄️
Lyophilized (powder)
-20°C · stable 2+ years
- ❄️
Reconstituted
2–8°C · use within 30 days
Sources & references
Peer-reviewed literature, for research context
- Proceedings of the National Academy of Sciences of the United States of America
Anticancer peptide PNC-27 adopts an HDM-2-binding conformation and kills cancer cells by binding to HDM-2 in their membranes
2010·DOI: 10.1073/pnas.0909364107·PMID: 20080680Sarafraz-Yazdi E, Bowne WB, Adler V, Sookraj KA, Wu V, Shteyler V
View source - Biomedicines
PNC-27, a Chimeric p53-Penetratin Peptide Binds to HDM-2 in a p53 Peptide-like Structure, Induces Selective Membrane-Pore Formation and Leads to Cancer Cell Lysis
2022·DOI: 10.3390/biomedicines10050945·PMID: 35625682Sarafraz-Yazdi E, Mumin S, Cheung D, Fridman D, Lin B, Wong L
View source - Annals of clinical and laboratory science
Anti-Cancer Peptide PNC-27 Kills Cancer Cells by Unique Interactions with Plasma Membrane-Bound hdm-2 and with Mitochondrial Membranes Causing Mitochondrial Disruption
2024·PMID: 38802154Krzesaj P, Adler V, Feinman RD, Miller A, Silberstein M, Yazdi E
View source - Anticancer research
Targeting Membrane HDM-2 by PNC-27 Induces Necrosis in Leukemia Cells But Not in Normal Hematopoietic Cells
2020·DOI: 10.21873/anticanres.14488·PMID: 32878773Thadi A, Lewis L, Goldstein E, Aggarwal A, Khalili M, Steele L
View source
More in Cellular
Every Cellular research compound in the catalog.
Important research notice
Not for human consumption. This product is sold exclusively for laboratory and in vitro research. It is not intended to diagnose, treat, cure, or prevent any disease.
Any research findings referenced on this page are drawn from published, peer-reviewed literature and are provided for educational context only. They are not product claims and should not be read as medical advice.
By purchasing, you confirm you are a qualified researcher and will handle this material in accordance with all applicable laws and institutional guidelines.


